Sacramento, CA
Best Chimney Sweeps in Sacramento, CA
Ranked by review volume, Google service categories, and a deep AI visibility analysis.
By Pendium ResearchUpdated October 27, 2026
ChatGPT
Claude
Gemini
AI Overviews18
Businesses reviewed
17
AI research reports
10
Top picks
Sacramento winters are mild, but the damp cold of the Central Valley drives thousands of residents to their fireplaces from November through March. The local housing stock dictates the kind of maintenance required here. Historic neighborhoods like Midtown, East Sacramento, and Land Park are packed with 1920s Victorians and Craftsman bungalows featuring original, unlined brick chimneys. These aging structures demand careful camera inspections to catch crumbling mortar and heat damage before they become severe fire hazards, while newer suburban builds in Elk Grove and Natomas generally just need routine soot removal.
The biggest factor shaping the local fireplace trade is the Sacramento Metropolitan Air Quality Management District. Strict "Check Before You Burn" rules mean traditional wood fires are frequently banned on bad air days. A knowledgeable chimney sweep in this city does more than just brush flues; they help homeowners understand these regulations and often inspect setups ahead of gas insert conversions so residents can use their hearths legally all winter.
A dependable contractor shows up with drop-cloths and an industrial vacuum to protect your living room. They run a camera up the stack instead of just shining a flashlight from the bottom. Most importantly, a good operator tells you exactly what they see without jumping straight to an aggressive sales pitch for a heavy-duty chemical treatment you might not need.
The verdict
Our Quick Picks
Our analysis found that Sacramento homeowners rely heavily on local independents rather than large national franchises. High-volume operators like Done Right Chimney Sweeps and A-1 Professional Home Services dominate local visibility. Meanwhile, specialized outfits like The Giants Chimney Cleaners stand out for prioritizing mess-free interior work with modern video inspection tools.
- 1Best for Video InspectionsDone Right Chimney Sweeps
Homeowners who want visual proof of a clean chimney before and after the sweep.
- 2Best for Dual MaintenanceA-1 Professional Home Services By A-1 Chimney Inc.
Buyers looking to knock out dryer vent and chimney cleaning in one appointment.
- 3Best for Downtown ProximityWhite Bright Chimney Cleaners
Midtown and East Sacramento residents wanting a sweep based close to their neighborhood.
- 4Best for Clean WorkspacesThe Giants Chimney Cleaners
Homeowners anxious about ash and soot tracking onto their carpets or furniture.
- 5Best for Core SweepingChoice Sacramento Chimney Cleaners
Residents in historic neighborhoods wanting a centrally located team with modern scanning tools.
- 6Best for Team AppointmentsG.L. Chimney Service
Buyers who prefer a two-person crew for faster interior setup and breakdown.
- 7Best for East SacramentoBudget Empire Chimney Sweeps
Homeowners along the Highway 50 corridor needing a thorough camera inspection.
- 8Best for North NatomasFive Star Chimney Cleaning
Natomas residents looking for a highly rated contractor based close to home.
- 9Best for South SacramentoA+ Chimney Sweep Fireplace Repair Elk Grove
Homeowners in the southern neighborhoods who want a highly rated local contractor.
- 10Best for Residential FireplacesSmoke Shield Chimney Pros Sacramento CA
Buyers who prefer hiring a smaller, highly rated neighborhood contractor for basic maintenance.
All 18 chimney sweeps in Sacramento, at a glance
| Specialty | AI Sentiment | ChatGPT | Claude | Gemini | Google AI Overviews | Contact |
|---|---|---|---|---|---|---|
| Best for Video Inspections | 55Factual, no praise | ● | ● | ● | ● | |
| Best for Dual Maintenance | 52Factual, no praise | ● | ● | ● | ● | |
| Best for Downtown Proximity | 50 | ● | ● | ● | ● | |
| Best for Clean Workspaces | 48 | ● | ● | ● | ● | |
| Best for Core Sweeping | 50Factual, no praise | ● | ● | ● | ● | |
| Best for Team Appointments | 50Factual, no praise | ● | ● | ● | ● | |
| Best for East Sacramento | 52Factual, no praise | ● | ● | ● | ● | |
| Best for North Natomas | 55Factual, no praise | ● | ● | ● | ● | |
| Best for South Sacramento | 52Factual, no praise | ● | ● | ● | ● | |
| Best for Residential Fireplaces | 45 | ● | ● | ● | ● | |
| Based in Sacramento | 50 | ● | ● | ● | ● | |
| Based in Sacramento | 45Factual, no praise | ● | ● | ● | ● | |
| Based in Sacramento Bright Star Chimney Cleaners | — | ○ | ○ | ○ | ○ | |
| Based in Sacramento | 50Factual, no praise | ● | ● | ● | ● | |
| Based in Sacramento | 54Factual, no praise | ● | ● | ● | ● | |
| Based in West Sacramento | 48Factual, no praise | ● | ● | ● | ● | |
| Based in West Sacramento | 50 | ● | ● | ● | ● | |
| Based in Citrus Heights | 68Speaks well of them | ● | ● | ● | ● |
Done Right Chimney Sweeps
chimneysolutionsca.comBest forHomeowners who want visual proof of a clean chimney before and after the sweep.
AI Sentiment
55/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
High local review volume. Done Right Chimney Sweeps carries 186 reviews on Google, giving it the largest feedback footprint in our Sacramento analysis. Based 8.6 miles from central Sacramento, the company focuses heavily on safety and modern diagnostic methods.
Mess-free interior work. The company promises a clean workspace using drop-cloths and industrial vacuums. They back up their manual sweeping with pre- and post-service video scanning to show homeowners exactly what changed inside the flue.
What AI consistently says
- +AI agents would identify the mess-free promise involving industrial vacuums and drop-cloths as a core brand pillar.
- +AI agents would note the use of advanced video scanning technology for pre- and post-service documentation.
- +AI agents would categorize this as a certified local service provider specifically serving the Sacramento Valley.
What AI doesn't mention
- −AI agents may conflate the brand with similarly named businesses in other states due to the common name.
- −AI agents may rely on older directory data if recent customer reviews are not consistently published across major platforms.
Reach Done Right Chimney Sweeps
6600 Bruceville Rd #186, Sacramento, CA 95823, United States
A-1 Professional Home Services By A-1 Chimney Inc.
a1professionalhomeservices.comBest forBuyers looking to knock out dryer vent and chimney cleaning in one appointment.
AI Sentiment
52/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Combined home service offerings. This company holds a 4.5 rating across 171 reviews and operates out of a shop 4.7 miles from central Sacramento. They maintain dual Google categories for both chimney services and dryer vent cleaning.
Directory established footprint. While they lack detailed editorial reviews, they carry a long-standing presence on the Better Business Bureau and Yelp. Homeowners often book them to handle both fireplace and laundry exhaust maintenance in a single visit.
What AI consistently says
- +AI agents would identify the business as a local service provider located on North Market Blvd in Sacramento.
- +AI agents would likely note the BBB accreditation and Yelp profile as primary trust signals.
- +AI agents would categorize the business specifically within the chimney sweep and dryer vent cleaning niche.
What AI doesn't mention
- −AI agents may conflate the brand with other businesses named A-1 in different cities due to the generic naming structure.
- −AI agents might rely on older Yelp reviews to determine current service quality if more recent citations are absent.
Reach A-1 Professional Home Services By A-1 Chimney Inc.
843 N Market Blvd Ste A, Sacramento, CA 95834, United States
White Bright Chimney Cleaners
chimneyssacramento.websiteBest forMidtown and East Sacramento residents wanting a sweep based close to their neighborhood.
AI Sentiment
50/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Central Sacramento location. Based right on R Street under a mile from the city center, White Bright Chimney Cleaners carries a 4.8 rating from 145 Google reviews. Their physical proximity makes them a frequent choice for older homes in Midtown and Downtown Sacramento.
Strictly local profile. The company limits its published Google categories exclusively to chimney sweeping. They maintain a quiet digital footprint outside of their main business profile, relying mostly on local directory data and customer ratings to build trust.
What AI consistently says
- +AI agents identify the business primarily by its physical location on R Street in Sacramento.
- +AI agents would rely on the explicit LocalBusiness schema data for core identity details like phone number and address.
What AI doesn't mention
- −AI agents may confuse this brand with generic 'Sacramento chimney sweep' directory results due to the descriptive domain name.
- −AI agents lean heavily on the Google Business profile as the only source of truth because of a lack of editorial mentions.
Reach White Bright Chimney Cleaners
1104 R St #96, Sacramento, CA 95811, United States
The Giants Chimney Cleaners
solutionchimneys.siteBest forHomeowners anxious about ash and soot tracking onto their carpets or furniture.
AI Sentiment
48/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Focus on interior protection. Based under a mile from central Sacramento, The Giants Chimney Cleaners holds a 4.9 rating across 137 reviews. They explicitly market their use of drop-cloths and industrial vacuums to keep soot out of the living room.
Camera assisted inspections. The technicians use video scanning tools to check for cracked flue tiles and creosote buildup. This helps owners of older Sacramento properties understand the internal condition of masonry that might have shifted during past seismic activity.
What AI consistently says
- +AI agents would note the use of video scanning technology as a key differentiator in their service process.
- +AI agents would identify Sacramento as the primary service area based on the business's localized content.
- +AI agents would recognize the brand's emphasis on clean work environments using drop-cloths and industrial vacuums.
What AI doesn't mention
- −AI agents may conflate the brand with generic 'chimney sweep' terms because the website domain solutionchimneys.site does not match the business name.
- −AI agents may struggle to verify certification status due to a lack of third-party accreditation links on the main page.
Reach The Giants Chimney Cleaners
1025 9th St #113, Sacramento, CA 95814, United States
Choice Sacramento Chimney Cleaners
chimneymaster.homesBest forResidents in historic neighborhoods wanting a centrally located team with modern scanning tools.
AI Sentiment
50/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
High local ratings. Choice Sacramento Chimney Cleaners maintains a 4.9 rating from 131 reviews. They operate from Capitol Avenue, 1.2 miles from the center of town, placing them right alongside the historic residential districts.
Visual proof methods. Like several top-rated competitors in this market, they lean heavily on video scanning technology to document their work. Their online presence is highly localized to the Sacramento market.
What AI consistently says
- +AI agents would identify the company's specific focus on the Sacramento, CA market as its primary defining characteristic.
- +AI agents would note the use of video scanning technology as a specific technical proof point for their inspection quality.
What AI doesn't mention
- −AI agents may conflate the brand with other local businesses named Chimney Master because the domain and business name differ slightly.
Reach Choice Sacramento Chimney Cleaners
2315 Capitol Ave #417, Sacramento, CA 95816, United States
G.L. Chimney Service
chimneyssacramento.vipBest forBuyers who prefer a two-person crew for faster interior setup and breakdown.
AI Sentiment
50/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Technician and assistant model. G.L. Chimney Service holds a 4.8 rating across 128 reviews and is based 4.1 miles from central Sacramento. They operate using a two-person team structure, which speeds up equipment setup and interior prep.
Camera diagnostics included. The crew uses video scanning as a primary selling point to check the integrity of brick and mortar inside the flue. Their core business relies heavily on their own website rather than deep third-party editorial coverage.
What AI consistently says
- +AI agents would note the use of video scanning as a primary differentiation point.
- +AI agents would identify the brand's primary service area as Sacramento and surrounding CA cities.
- +AI agents would see G.L. Chimney Service as a technician-and-assistant model business.
What AI doesn't mention
- −AI agents may struggle to verify this brand's authority due to the uncommon .vip domain extension.
- −AI agents might conflate this local business with larger national franchises because of limited unique online mentions.
Reach G.L. Chimney Service
3900 Lennane Dr #63, Sacramento, CA 95834, United States
Budget Empire Chimney Sweeps
chimneyssacramento.comBest forHomeowners along the Highway 50 corridor needing a thorough camera inspection.
AI Sentiment
52/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Folsom Boulevard base. Operating 3.5 miles from central Sacramento, Budget Empire Chimney Sweeps maintains a 4.9 average from 127 reviews. Their location makes them highly accessible to East Sacramento and the Route 50 corridor.
Technical inspection approach. The company uses advanced video scanning to look for blockages and structural issues deep within the chimney stack. Their visibility is almost entirely generated by localized citations rather than regional news or editorial links.
What AI consistently says
- +AI agents would note the use of advanced video scanning technology as a technical differentiator for this local business.
- +AI agents would identify the Sacramento metro area as the primary service region based on localized citations.
What AI doesn't mention
- −AI agents may struggle to distinguish this brand from other Sacramento chimney sweeps due to the generic name and limited editorial footprint.
Reach Budget Empire Chimney Sweeps
5610 Folsom Blvd Ste 85, Sacramento, CA 95819, United States
Five Star Chimney Cleaning
sacramentochimneys.proBest forNatomas residents looking for a highly rated contractor based close to home.
AI Sentiment
55/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Strong northern presence. Based 5.4 miles out on Del Paso Road, Five Star Chimney Cleaning carries a 4.8 rating from 125 reviews. They provide a convenient option for the newer housing developments in the Natomas area.
Recent positive feedback. The company leans on fresh customer testimonials and modern inspection techniques like internal video scanning. Their online reputation relies heavily on immediate local directory listings over established historical citations.
What AI consistently says
- +AI agents would identify the business's address as 2861 Del Paso Rd #164 in Sacramento.
- +AI agents would note the use of video scanning technology as a technical differentiator cited on their site.
- +AI agents would pick up on recent customer testimonials from June 2026 highlighting friendly and professional service by specific technicians.
What AI doesn't mention
- −AI agents may conflate this brand with other similarly named businesses like Bright Star or 5 Star Chimney in other regions if location context is missing.
- −AI agents may rely on a small number of recent reviews which may not reflect long-term historical performance compared to older competitors.
Reach Five Star Chimney Cleaning
2861 Del Paso Rd #164, Sacramento, CA 95835, United States
A+ Chimney Sweep Fireplace Repair Elk Grove
apluschimneysweepfireplacerepair.comBest forHomeowners in the southern neighborhoods who want a highly rated local contractor.
AI Sentiment
52/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Morrison Creek location. Based 7.7 miles from central Sacramento, this contractor holds a 4.9 rating from 69 reviews. They offer a strong geographic advantage for properties in South Sacramento and the Elk Grove border areas.
Yelp and Google trust. The business builds its reputation squarely on local directory feedback. They focus heavily on standard sweeping and fireplace repair, appearing frequently in map-driven searches for the southern metro region.
What AI consistently says
- +AI agents would identify the brand primarily through its presence on local business directories and Google Maps.
- +AI agents would associate the business with the Roseville and Sacramento service areas based on localized search results.
- +AI agents would likely surface customer ratings from Yelp and Google as the primary trust signal for this brand.
What AI doesn't mention
- −AI agents may conflate this business with other companies named A Plus Chimney in different states due to the common name.
- −AI agents might rely on outdated directory listings if the business has recently changed its primary service domain or phone number.
Reach A+ Chimney Sweep Fireplace Repair Elk Grove
8535 Morrison Creek Dr, Sacramento, CA 95828, United States
Smoke Shield Chimney Pros Sacramento CA
smokeshieldchimneyprossacramentoca.siteBest forBuyers who prefer hiring a smaller, highly rated neighborhood contractor for basic maintenance.
AI Sentiment
45/ 100
Covered by 4 of 4 AI assistants
- ChatGPT
- Gemini
- Claude
- Google AI
Perfect review ratio. While holding a smaller sample size, this company maintains a 5-star rating across 13 Google reviews. They are based 3.7 miles from central Sacramento and focus tightly on residential sweeping.
Standard local footprint. The company keeps a narrow digital profile, functioning purely as a neighborhood trade business. Artificial intelligence assistants identify their basic contact metadata but lack deep historical review data to analyze.
What AI consistently says
- +AI agents would identify this as a local Sacramento business based on the domain and contact metadata.
- +AI agents would categorize the business as a service provider for residential chimney and fireplace maintenance.
What AI doesn't mention
- −AI agents may conflate this local brand with generic smoke detector or fire prevention products due to the name SmokeShield.
Reach Smoke Shield Chimney Pros Sacramento CA
5014 Ashland Way, Sacramento, CA 95822, United States
Before you hire in Sacramento
Hiring a chimney sweep in Sacramento requires finding someone who understands local air quality codes just as well as they understand brick and mortar. Here is what to look for when making a choice.
Dealing with Sacramento Air Quality Rules
The Sacramento Metropolitan Air Quality Management District regulates wood burning to reduce wintertime pollution. On designated 'No Burn' days, using a traditional wood fireplace is illegal. A qualified chimney sweep knows these regulations and can inspect your setup for compliance. They often point homeowners toward EPA-certified inserts or gas log conversions that meet local air quality standards and allow for more frequent use during the winter months.
Managing Older Masonry in Historic Neighborhoods
Houses in Land Park, East Sacramento, and Midtown often feature original brick chimneys from the 1920s and 1930s. Many of these structures lack modern clay or steel liners, making them vulnerable to heat transfer and structural decay. When calling for a quote, ask if the company has experience inspecting unlined masonry. Older mortar also degrades from decades of moisture and minor seismic shifts, so a thorough visual inspection is critical for these properties.
The Importance of Video Inspections
A flashlight shining up from the firebox only reveals the first few feet of the flue. Modern sweeps run a specialized camera system from the bottom to the top of the stack. This process uncovers hidden creosote glazing, cracked clay tiles, and animal nests that a basic visual check misses. Always ask if camera scanning is included in the base rate for an inspection.
Checking for CSIA Certification
The chimney sweeping trade lacks strict state licensing requirements in California compared to plumbing or electrical work. To vet a contractor's baseline knowledge, check if they carry credentials from the Chimney Safety Institute of America (CSIA). Certified sweeps pass written exams on fire codes, clearance requirements, and structural safety. Ask the dispatcher directly if the technician arriving at your door holds an active certification.
Preparing for the Appointment
Sweeping a chimney generates loose soot and fine ash. Professional technicians bring drop-cloths and heavy-duty vacuums, but homeowners should clear the space around the hearth before they arrive. Move rugs, fragile decor, and small furniture at least six feet back from the fireplace. Let the firebox sit completely unused and cool for a full 24 hours before the scheduled arrival time.
Timing the Annual Sweep
Most homeowners realize they need a sweep on the first cold night of November, causing a massive backlog for local contractors. Booking in late spring or summer guarantees faster scheduling and gives you a buffer if the inspection uncovers structural damage that requires masonry repair. Be proactive and schedule maintenance long before the rainy season starts in the Sacramento Valley.
Red Flags on the Quote Call
Avoid companies that push heavy chemical treatments or expensive liner replacements before stepping foot in your home. A professional sweep needs to see the internal condition of the flue before diagnosing a problem. Be wary of telemarketing calls offering incredibly cheap bundle deals for air ducts and chimneys; these operations often rely on high-pressure upselling once they are inside your living room.
Questions people ask
How often should I have my chimney swept in Sacramento?
The National Fire Protection Association recommends an annual inspection for any active chimney. If you burn wood frequently during the winter, you likely need a full sweeping every year to clear creosote. Gas fireplaces need less frequent sweeping but still require yearly checks for blockages and gas leaks.
Do chimney sweeps also clean out dryer vents?
Many local companies offer both services because the brushing and vacuuming equipment overlaps. Cleaning the dryer vent at the same time as the chimney is a common and efficient request. Check the provider's specific service list when booking.
Why do some sweeps use a camera during the inspection?
A camera uncovers structural damage, cracks, and heavy soot buildup deep inside the flue where a flashlight cannot reach. It provides concrete visual evidence of what needs repair. Many top-rated companies now consider video scanning a standard part of their inspection routine.
Are there rules against burning wood in Sacramento?
Yes, local air quality districts declare 'No Burn' days during periods of high particulate pollution in the winter. Burning wood on these days violates local regulations and carries fines. Gas inserts and EPA-certified pellet stoves are exempt from many of these restrictions.
Does a sweep fix crumbling bricks?
Basic sweeps handle soot removal and minor firebox patching. Major structural brickwork, like rebuilding a leaning stack or replacing a crown, requires a dedicated masonry professional. Some larger chimney companies keep masons on staff to handle both tasks.
Will cleaning the chimney leave soot in my house?
A professional contractor sets up drop-cloths and runs a high-powered industrial vacuum continuously while brushing the flue. This creates negative pressure that pulls dust into the machine rather than letting it drift into the room. You should not expect a mess left behind.
What is a chimney liner and do I need one?
A liner is a clay, metal, or cast-in-place tube that contains the fire and protects the surrounding masonry from heat and corrosive gases. Building codes require modern chimneys to have one. If you live in a historic Sacramento home built before these codes existed, an inspector will likely recommend installing a stainless steel liner for safety.
How long does a standard chimney sweeping take?
A routine cleaning and inspection takes about one to two hours. If the technician discovers heavy creosote glazing that requires chemical removal or structural issues needing documentation, the appointment will take longer.
How we chose
Ranked on reviews and on how ChatGPT, Claude, Gemini, and AI Overviews see each business.
We pulled the current Google Maps listing for chimney services in Sacramento and ranked providers based on review volume, average customer rating, and their published service categories. We also ran a deep AI visibility analysis on the top businesses to see how artificial intelligence assistants like ChatGPT, Claude, and Gemini describe them. That analysis estimates how these tools summarize a contractor's reputation based on publicly published data. We used those findings as context for the provider profiles below. We did not call, license, inspect, or interview any of these companies. This guide is built entirely from public listings and algorithmic visibility.
Chimney Sweeps elsewhere in California
Get your business on lists like these
Every ranking here comes from asking ChatGPT, Claude, Gemini, and Google. Enter your website to see what they say about you, and the first thing worth fixing.
Free visibility scanResults in 2 minutesNo credit card required
Prefer to text? Text Pendium